Menu
Peptide Database
Results
No peptides found
Featured

Use search to browse all 100+ peptides

LL-37

Cathelicidin, hCAP-18, FALL-39, CAP-18

Quick Stats
Studies 2230
Trials 95
Score 2
2019 pubmed 24 citations

Degradable dendritic nanogels as carriers for antimicrobial peptides.

Nordström. Randi R; Andrén. Oliver C J OCJ; Singh. Shalini S; Malkoch. Michael M; Davoudi. Mina M; Schmidtchen. Artur A; Malmsten. Martin M

Key Findings

  • Nanogels bind LL‑37 mainly on their surface; loading isn’t affected by the gel’s charge density.
  • LL‑37 is released quickly at body‑like salt levels, and its antibacterial activity is the same whether free or attached to the nanogel.
  • Both the nanogels and the peptide are low‑toxicity to red blood cells even at high concentrations.

Practical Outcomes

  • For DIY health enthusiasts, the study shows that LL‑37 can be used as an antimicrobial without needing special carriers, as the nanogels don’t improve its stability or potency. The nanogel system is still experimental and not something you can readily apply at home, but it confirms LL‑37’s safety at micromolar doses.

Summary

Scientists tested tiny, biodegradable gel particles (nanogels) that can hold the antimicrobial peptide LL‑37. The gels stick to the peptide but don’t let it go inside, so the peptide is released quickly and still kills bacteria. The gels themselves aren’t toxic to red blood cells, but they don’t make LL‑37 work any better than the free peptide.

Abstract

In the present study, we investigate degradable anionic dendritic nanogels (DNG) as carriers for antimicrobial peptides (AMPs). In such systems, the dendritic part contains carboxylic acid-based anionic binding sites for cationic AMPs, whereas linear poly(ethylene glycol) (PEG) chains form a shell for promotion of biological stealth. In order to clarify factors influencing membrane interactions of such systems, we here address effects of nanogel charge, cross-linking, and degradation on peptide loading/release, as well as consequences of these factors for lipid membrane interactions and antimicrobial effects. The DNGs were found to bind the AMPs LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW). For the smaller DPK-060 peptide, loading was found to increase with increasing nanogel charge density. For the larger LL-37, on the other hand, peptide loading was largely insensitive to nanogel charge density. In line with this, results on the secondary structure, as well as on the absence of stabilization from proteolytic degradation by the nanogels, show that the larger LL-37 is unable to enter into the interior of the nanogels. While 40-60% nanogel degradation occurred over 10 days, promoted at high ionic strength and lower cross-linking density/higher anionic charge content, peptide release at physiological ionic strength was substantially faster, and membrane destabilization not relying on nanogel degradation. Ellipsometry and liposome leakage experiments showed both free peptide and peptide/DNG complexes to cause membrane destabilization, indicated also by antimicrobial activities being comparable for nanogel-bound and free peptide. Finally, the DNGs were demonstrated to display low toxicity towards erythrocytes even at peptide concentrations of 100 µM.

Study Information

Provider

pubmed

Year

2019

Date

2019-07-13T00:00:00.000Z

DOI

10.1016/j.jcis.2019.07.028

Citations

24

References

55