Menu
Peptide Database
Results
No peptides found
Featured

Use search to browse all 100+ peptides

LL-37

Cathelicidin, hCAP-18, FALL-39, CAP-18

Quick Stats
Studies 2230
Trials 95
Score 2
2017 pubmed 58 citations

Membrane interactions of microgels as carriers of antimicrobial peptides.

Nordström. Randi R; Nyström. Lina L; Andrén. Oliver C J OCJ; Malkoch. Michael M; Umerska. Anita A; Davoudi. Mina M; Schmidtchen. Artur A; Malmsten. Martin M

Key Findings

  • Anionic microgels can load high amounts of LL‑37 and protect it from protease degradation.
  • Both empty and peptide‑loaded microgels do not attach to or disrupt bacterial‑mimicking membranes; antimicrobial activity relies on peptide release.
  • Factors that increase peptide release—shorter peptide length and lower microgel charge density—enhance killing of MRSA, E. coli, and P. aeruginosa.
  • The microgel‑peptide system shows low toxicity toward erythrocytes.

Practical Outcomes

  • For DIY health enthusiasts, the research suggests that formulating LL‑37 with negatively charged polymer microgels could protect the peptide until it’s needed, but you’ll still need a way to trigger its release for antibacterial action. The findings are most relevant for topical or wound‑care applications rather than systemic use, and setting up such microgel delivery systems may require specialized chemistry skills.

Summary

The study shows that negatively charged microgel particles can hold a lot of the antimicrobial peptide LL‑37 and keep it safe from enzymes that would break it down. However, the microgels themselves don’t kill bacteria – the peptide has to be released first. Releasing the peptide faster (by using a shorter version or a less strongly charged microgel) makes the antibacterial effect stronger, and the formulation appears safe for red blood cells.

Abstract

Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density. As a result of their net negative z-potential also at high peptide loading, neither empty nor peptide-loaded microgels adsorb at supported bacteria-mimicking membranes. Instead, membrane disruption is mediated almost exclusively by peptide release. Mirroring this, antimicrobial effects against several clinically relevant bacteria (methicillin-resistant Staphylococcus aureus (MRSA), Escherichia coli, and Pseudomonas aeruginosa) were found to be promoted by factors facilitating peptide release, such as decreasing peptide length and decreasing microgel charge density. Microgels were further demonstrated to display low toxicity towards erythrocytes. Taken together, the results demonstrate some interesting opportunities for the use of microgels as delivery systems for antimicrobial peptides, but also highlight several key factors which need to be controlled for their successful use.

Study Information

Provider

pubmed

Year

2017

Date

2017-11-06T00:00:00.000Z

DOI

10.1016/j.jcis.2017.11.014

Citations

58

References

41