Menu
Peptide Database
Results
No peptides found
Featured

Use search to browse all 100+ peptides

LL-37

Cathelicidin, hCAP-18, FALL-39, CAP-18

Quick Stats
Studies 2230
Trials 95
Score 1
2006 pubmed 31 citations

Modulation by LL-37 of the responses of salivary glands to purinergic agonists.

Pochet. Stéphanie S; Tandel. Séverine S; Querriére. Stéphanie S; Tre-Hardy. Marie M; Garcia-Marcos. Mikel M; De Lorenzi. Manuela M; Vandenbranden. Michel M; Marino. Aida A; Devleeschouwer. Michel M; Dehaye. Jean-Paul JP

Key Findings

  • LL‑37 boosts calcium uptake and activates a calcium‑independent PLA2 in mouse submandibular gland cells
  • LL‑37 does not act via P2X7 receptors and its effects persist in mice lacking these receptors
  • LL‑37 increases plasma membrane fluidity and modulates responses to ATP without major cell damage

Practical Outcomes

  • For biohackers, this research offers limited direct use. It suggests LL‑37 can influence salivary gland signaling, but there’s no clear dosage or protocol for humans, and safety/efficacy data are lacking. Until more applied studies appear, LL‑37 remains a mechanistic curiosity rather than a practical supplement.

Summary

The study shows that the antimicrobial peptide LL‑37 can change how mouse salivary gland cells handle calcium and certain enzymes, but it doesn’t work through the usual P2X7 receptor pathway and the effects were seen only in isolated mouse cells.

Abstract

The interaction of mice submandibular gland cells with LL-37 ([LL-37, 37 aa]), a cationic peptide with immunomodulatory properties, was investigated. LL-37 at a concentration that did not affect the integrity of the cells increased the uptake of calcium and activated a calcium-insensitive phospholipase A(2) (PLA(2)). The small release of ATP induced by LL-37 could not account for this stimulation because apyrase did not significantly block the response to LL-37. The divalent cation magnesium inhibited the response to LL-37, but this inhibition was probably nonspecific because it also inhibited the in vitro bacteriostatic effect of the peptide. The increase of calcium uptake by LL-37 was not affected by 1-[N,O-bis(5-isoquinolinesulfonyl)-N-methyl-L-tyrosyl]-4-phenylpiperazine (KN-62), a rather specific inhibitor of P2X(7) receptors in mice. LL-37 also increased [Ca(2+)](i) in cells from mice invalidated for these receptors. LL-37 had no effect on the response to carbachol. It inhibited the increase of [Ca(2+)](i) and the activation of phospholipase D by ATP. It potentiated the activation of the PLA(2) by the nucleotide. Finally, LL-37 increased the fluidity of the plasma membrane of submandibular gland cells. In conclusion, our results suggest that LL-37 is an autocrine regulator of submandibular gland cells. It does not stimulate mouse P2X(7) receptors but modulates their responses.

Study Information

Provider

pubmed

Year

2006

Date

2006-03-02T00:00:00.000Z

DOI

10.1124/mol.105.021444

Citations

31

References

42